USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
English
Germany GermanyFrance FranceSpain SpainPortugal Portugal
0 items
New Products
Product Details
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
The Lynx Horse bow
Product Code:Pfi9cpq
Product Condition:New
$325.00 inc. tax
Add to Cart
Description
This little “Horsebow” is ideal for mounted archery or as a starter bow for children.

Available with your choice of riser timber and poundage. 20# to 50#

At 54" unstrung and only 50" nock to nock strung this compact little bow packs a punch.

We will contact you to customize your bow upon receipt of your order.
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i