USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
English
Germany GermanyFrance FranceSpain SpainPortugal Portugal
0 items
New Products
Product Details
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Dual purpose Quiver
Product Code:rtlodem
Product Condition:New
$110.00 inc. tax
Add to Cart
Description
Dual purpose quiver to be used as a back quiver or side quiver depending on its purpose at the time.

See the video in our media section for more details.
https://www.instagram.com/p/CWJSKCbglVt/
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i